19816811.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title 192.168.1.1 |
Description N/A
Keywords N/A
Server Information
WebSite 19816811 favicon www.19816811.com
Host IP 83.150.213.222
Location Turkey
Related Websites
Site Rank
More to Explore
225batonrouge.com
2winglobal.com
3798blog.com
42podarka.ru
51logon.com
51xyyx.com
aba-sys.com
abbasi1357.blogfa.com
abhisheksuneri.com
acheterpaschernikeflyknitairmaxvivid.info
theragdepotvintage.com
thesagemethod.com
19816811.com Valuation
US$2,195
Last updated: Nov 23, 2019

19816811.com has global traffic rank of 7,685,374. 19816811.com has an estimated worth of US$ 2,195, based on its estimated Ads revenue. 19816811.com receives approximately 400 unique visitors each day. Its web server is located in Turkey, with IP address 83.150.213.222. According to SiteAdvisor, 19816811.com is unknown to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$2,195
Daily Ads Revenue US$1
Monthly Ads Revenue US$36
Yearly Ads Revenue US$439
Daily Unique Visitors 400
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 7,685,374
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
19816811.com A 14399 IP: 83.150.213.222
19816811.com MX 14399 Priority: 10
Target: 19816811.com.
19816811.com NS 21599 Target: ns1.internetbilisim.net.
19816811.com NS 21599 Target: ns2.internetbilisim.net.
19816811.com TXT 14399 TXT: v=spf1 include:relay.mailchannels.net ~all
19816811.com SOA 21599 MNAME: ns1.internetbilisim.net.
RNAME: aytekineke.gmail.com.
Serial: 2019110900
Refresh: 86400
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
HTTP Headers
HTTP/1.1 301 Moved Permanently
Connection: Keep-Alive
Content-Type: text/html
Content-Length: 705
Date: Sat, 23 Nov 2019 21:43:10 GMT
Server: LiteSpeed
Location: https://19816811.com/
Vary: User-Agent

HTTP/2 200 
content-type: text/html; charset=UTF-8
link: <https://19816811.com/wp-json/>; rel="https://api.w.org/"
link: <https://19816811.com/>; rel=shortlink
date: Sat, 23 Nov 2019 21:43:11 GMT
server: LiteSpeed
vary: User-Agent
alt-svc: quic=":443"; ma=2592000; v="39,43,46", h3-Q039=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-22=":443"; ma=2592000

19816811.com Whois Information
   Domain Name: 19816811.COM
   Registry Domain ID: 2281784720_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.aerotek.com.tr
   Registrar URL: http://www.aerotek.com.tr
   Updated Date: 2019-05-11T08:18:49Z
   Creation Date: 2018-07-02T19:16:35Z
   Registry Expiry Date: 2020-07-02T19:16:35Z
   Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
   Registrar IANA ID: 1534
   Registrar Abuse Contact Email: registrar_abuse@aerotek.com.tr
   Registrar Abuse Contact Phone: +902623245555
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: NS1.INTERNETBILISIM.NET
   Name Server: NS2.INTERNETBILISIM.NET
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: 19816811.COM
Registry Domain ID: 2281784720_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.aerotek.com.tr
Registrar URL: 
Updated Date: 2019-05-11T08:18:49Z
Creation Date: 2018-07-02T19:16:35Z
Registrar Registration Expiration Date: 2020-07-02T19:16:35Z
Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
Registrar IANA ID: 1534
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Domain Admin
Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org)
Registrant Street: 10 Corporate Drive   
Registrant City: Burlington
Registrant State/Province: MA
Registrant Postal Code: 01803
Registrant Country: US
Registrant Phone: +1.8022274003
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: contact@privacyprotect.org
Registry Admin ID: Not Available From Registry
Admin Name: Domain Admin
Admin Organization: Privacy Protect, LLC (PrivacyProtect.org)
Admin Street: 10 Corporate Drive   
Admin City: Burlington
Admin State/Province: MA
Admin Postal Code: 01803
Admin Country: US
Admin Phone: +1.8022274003
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: contact@privacyprotect.org
Registry Tech ID: Not Available From Registry
Tech Name: Domain Admin
Tech Organization: Privacy Protect, LLC (PrivacyProtect.org)
Tech Street: 10 Corporate Drive   
Tech City: Burlington
Tech State/Province: MA
Tech Postal Code: 01803
Tech Country: US
Tech Phone: +1.8022274003
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: contact@privacyprotect.org
Name Server: ns1.internetbilisim.net
Name Server: ns2.internetbilisim.net
DNSSEC: Unsigned
Registrar Abuse Contact Email: logicbox@aerotek.com.tr
Registrar Abuse Contact Phone: +90.2623245555
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

Registration Service Provided By: AEROTEK

PRIVACYPROTECT.ORG is providing privacy protection services to this domain name to 
protect the owner from spam and phishing attacks. PrivacyProtect.org is not 
responsible for any of the activities associated with this domain name. If you wish 
to report any abuse concerning the usage of this domain name, you may do so at 
http://privacyprotect.org/contact. We have a stringent abuse policy and any 
complaint will be actioned within a short period of time.